PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s0363.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 683aa    MW: 76074.8 Da    PI: 6.5147
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s0363.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-184495556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++t++q++eLe++Fe+n+ p++++r eL ++l+L+ +qVk+WFqN+R++ k
  Bostr.7867s0363.1.p 44 HRHTDYQIQELENFFENNPLPTEDQRYELGQRLNLEAKQVKFWFQNKRTQVK 95
                         579*********************************************9876 PP

2START174.28.2e-552144322206
                          HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                          la++a++el+ + + ++p+W+ +      s+++++++  f  +     + +ea+r++g+v+m++ +l ++l+d++ +W   +a     a+
  Bostr.7867s0363.1.p 214 LANTAMKELIVLGEMDCPFWTIDLrskeVSLIYEKYRGVFNNNIKppgCVVEASRDIGLVPMTSSTLAKTLMDTG-KWVDVFAsivpVAS 302
                          6899********************999999**********77776******************************.*******9999*** PP

                          EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
                START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                          t++vi++g      g lq+++ae+q +splvp R ++f+Ry+++l+ g wv+vd  v++ ++p+   ++  +++lpSg++ie+++ng+sk
  Bostr.7867s0363.1.p 303 THKVIRTGtgggksGSLQQIQAEFQIISPLVPmRQVTFLRYCKELRHGLWVVVD--VTPAEYPT-FLPYGASNRLPSGLIIEDMANGYSK 389
                          ******************************************************..********.8************************ PP

                          EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          vtw+e+++++++++h+l+++l++sg+  gak+w+atlqr+ce+
  Bostr.7867s0363.1.p 390 VTWIEQAEYNENHIHQLYQPLIGSGIGLGAKRWLATLQRYCES 432
                          *****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-182795IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-193095IPR009057Homeodomain-like
PROSITE profilePS5007116.5843797IPR001356Homeobox domain
SMARTSM003892.0E-1538101IPR001356Homeobox domain
CDDcd000861.06E-154195No hitNo description
PfamPF000464.8E-164495IPR001356Homeobox domain
PROSITE profilePS5084836.389204435IPR002913START domain
SuperFamilySSF559611.47E-23207432No hitNo description
CDDcd088752.46E-88208431No hitNo description
SMARTSM002344.5E-51213432IPR002913START domain
PfamPF018527.7E-51214432IPR002913START domain
SuperFamilySSF559618.15E-12455645No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006349Biological Processregulation of gene expression by genetic imprinting
GO:0009911Biological Processpositive regulation of flower development
GO:0031047Biological Processgene silencing by RNA
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MNGQGDFDEF KYIPDPNLGR AEDEESDIMS CDNDRDGGRM RRSHRHTDYQ IQELENFFEN  60
NPLPTEDQRY ELGQRLNLEA KQVKFWFQNK RTQVKINRER LQNRALIEDH DSLLGAQEQL  120
RCAMLRSSCN ICGRATNCGD VDYEVQKLMV ENIRLKREID PYSSFLCDPV QVQVSPPEPV  180
PSSSSNPGRN ATPQLDLGCG TTSAKKERSK FLDLANTAMK ELIVLGEMDC PFWTIDLRSK  240
EVSLIYEKYR GVFNNNIKPP GCVVEASRDI GLVPMTSSTL AKTLMDTGKW VDVFASIVPV  300
ASTHKVIRTG TGGGKSGSLQ QIQAEFQIIS PLVPMRQVTF LRYCKELRHG LWVVVDVTPA  360
EYPTFLPYGA SNRLPSGLII EDMANGYSKV TWIEQAEYNE NHIHQLYQPL IGSGIGLGAK  420
RWLATLQRYC ESLLTLSSTN LGEISPGLSA KGATELVKLV QRMTLSYYKG ITGSTVAKWE  480
IIQVENVAQN MILMTRKNLN EPGEHTGIVL SAATSVWFPV NQQTLFAFLS HPSFRHEWDI  540
LTNNTSMEET IRIQKAKRHG NIISLLRIIG NGMLVLQEVW NDASGAVLVY APVETSSIEP  600
VKRSENSDSV QLLPSGFSIL PDGVTDHKGK SKTGGGCLLT LGLQILVSSN PTAELTQDSV  660
KIVEELMVHT IGKIKSALHI QT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3678170.0AB367817.1 Turritis glabra FWA mRNA for homeodomain-containing transcription factor FWA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567722.10.0homeobox-leucine zipper protein HDG6
SwissprotQ9FVI60.0FWA_ARATH; Homeobox-leucine zipper protein HDG6
TrEMBLB5BQ030.0B5BQ03_TURGL; Homeodomain-containing transcription factor FWA
STRINGAT4G25530.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2095355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25530.10.0FLOWERING WAGENINGEN